PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1878s0002.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 72aa    MW: 8346.5 Da    PI: 8.4901
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1878s0002.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY26.11.7e-088372958
                         STT---EEEEEE-SSSTTEEEEEEES--SS CS
                 WRKY 29 sagCpvkkkversaedpkvveitYegeHnh 58
                         +++C vkk+ve   +dp++v++tYe +Hn 
  Kalax.1878s0002.2.p  8 TQQCIVKKRVEGLFQDPSTVITTYERQHNN 37
                         579*************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081110.005140IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.5E-7738IPR003657WRKY domain
SuperFamilySSF1182903.66E-6838IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 72 aa     Download sequence    Send to blast
MICYGYMTQQ CIVKKRVEGL FQDPSTVITT YERQHNNHCQ ATLRGNVFID LSSYTKQKST  60
HEKPEETRHL I*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306743.11e-13hypothetical protein POPTR_0005s22480g
TrEMBLB9H8231e-13B9H823_POPTR; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.13e-12WRKY DNA-binding protein 71